PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G0859
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 505aa    MW: 57046.6 Da    PI: 7.6023
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G0859genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.75.6e-132367348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W +eEd++l + + ++G+ +W+ Ia+++   +t  qc+ rw++yl
      Gh_A03G0859 23 TWAQEEDDILREQISLHGTQNWAIIASKFK-DKTTRQCRRRWYTYL 67
                     6****************************9.*************97 PP

2Myb_DNA-binding43.57.1e-1473116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
      Gh_A03G0859  73 KGGWSPEEDMLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 116
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.6831671IPR017930Myb domain
SMARTSM007178.7E-122069IPR001005SANT/Myb domain
SuperFamilySSF466896.36E-2521114IPR009057Homeodomain-like
CDDcd001673.10E-112367No hitNo description
PfamPF139215.3E-152484No hitNo description
Gene3DG3DSA:1.10.10.606.2E-202475IPR009057Homeodomain-like
PROSITE profilePS5129416.97572122IPR017930Myb domain
SMARTSM007171.1E-1472120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-1976121IPR009057Homeodomain-like
CDDcd001671.57E-1076117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MQETKNKNGG NEDSKKKERH IVTWAQEEDD ILREQISLHG TQNWAIIASK FKDKTTRQCR  60
RRWYTYLNSD FKKGGWSPEE DMLLCEAQKI FGNRWTEIAK VVSGRTDNAV KNRFSTLCKK  120
RAKYEALAKE NSNSCINPNN KRILLQNGFN TDGTTDSAAP VKRMRYHSIN DKCRIMYIHS  180
NGLKSKSFLF PHFRRSHIPD LTESCNFGDR AHRVSGTIIN QQLRHPFAVL GQNLHNANNL  240
VQPQVNKVKD VSDDAQSYRT QGTFLKKDDP KITALMQQAE LLSSLALKVN TDGTEESLEN  300
AWKVLQDFLN QSKENDTFRY TISDIDFQIE DFKDLLEDLR SSNEGSQQSW RQPDLYEVSP  360
SSSEYSTGST IMPHPAGERG EKTQAKIDEL HPDILSNHIG EQNCSTEEET RALSSANKNH  420
GEMISSSDDQ TNIIVASTSS SAEFSSPVQV TPLFRSLAAG IPSPKFSESE RNFLLKTLGM  480
ESPSPSPANN LSQPPPCKRA LLHSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-262412110107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012478664.10.0PREDICTED: myb-like protein Q isoform X1
TrEMBLA0A0D2RET90.0A0A0D2RET9_G
STRINGVIT_01s0026g01910.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.20.0myb domain protein 88